PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_016498681.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family M-type_MADS
Protein Properties Length: 319aa    MW: 36840.3 Da    PI: 8.8114
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_016498681.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF42.11.1e-131152344
                    --SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTS CS
          SRF-TF  3 ienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstg 44
                    i+ +  r+ tf kR++g++KK +E  +LC+++ ++i++++++
  XP_016498681.1 11 ISKEKARNATFKKRKEGLMKKLYEFTTLCNVNGCMIMYGPKQ 52
                    888999*********************************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004321.0E-13165IPR002100Transcription factor, MADS-box
PROSITE profilePS5006616.147161IPR002100Transcription factor, MADS-box
SuperFamilySSF554551.57E-16161IPR002100Transcription factor, MADS-box
CDDcd002661.37E-18295No hitNo description
PRINTSPR004041.2E-6323IPR002100Transcription factor, MADS-box
PfamPF003196.8E-151152IPR002100Transcription factor, MADS-box
PRINTSPR004041.2E-62338IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 319 aa     Download sequence    Send to blast
MGRAKLKMEL ISKEKARNAT FKKRKEGLMK KLYEFTTLCN VNGCMIMYGP KQNNGSNSEP  60
EIWTNNSMQS GTSTNKTLQV EEIQNLIDEY KKESSTKTFG LSDYFLNRNK KVEEELIKLR  120
KKNMQKKYPC WLEFMNQLSE VKLREFLTLL DDKVEKVKSR IDLLKGNFSS EGLSQLTNNN  180
DNVNPLLVQG GMEYGGNFIN NNQEQAAIYP YCNSIINHQE MMMLMMNEND WQYNGASSSS  240
SSNGIGSNNM RCALMKYETM MSHNMMLNSQ MPYSSPYVAP TILQPTPYII MPSALPQMYH  300
PMKENEQDEK LKLSSYLRH
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009621899.10.0PREDICTED: agamous-like MADS-box protein AGL80
RefseqXP_016498681.10.0PREDICTED: agamous-like MADS-box protein AGL80
TrEMBLM1CBS41e-141M1CBS4_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000641201e-140(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA24572253
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G55690.12e-19M-type_MADS family protein